Structure of PDB 3kik Chain D Binding Site BS02

Receptor Information
>3kik Chain D (length=92) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINE
STNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ
Ligand information
>3kik Chain H (length=28) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSTIDSISNGILNNLLTTLIQDIVARET
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kik Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1
Resolution2.1 Å
Binding residue
(original residue number in PDB)		L29 L33 K43 T46 K47 M50 A69 L70 L82 I85 R86 L89
Binding residue
(residue number reindexed from 1)		L25 L29 K39 T42 K43 M46 A65 L66 L78 I81 R82 L85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0008047 enzyme activator activity
Biological Process
GO:0000973 post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0006325 chromatin organization
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0006406 mRNA export from nucleus
GO:0015031 protein transport
GO:0016973 poly(A)+ mRNA export from nucleus
GO:0032880 regulation of protein localization
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051028 mRNA transport
GO:0071028 nuclear mRNA surveillance
Cellular Component
GO:0000124 SAGA complex
GO:0000932 P-body
GO:0005634 nucleus
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0046695 SLIK (SAGA-like) complex
GO:0070390 transcription export complex 2
GO:0071819 DUBm complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3kik, PDBe:3kik, PDBj:3kik
PDBsum3kik
PubMed20007317
UniProtQ6WNK7|SUS1_YEAST Transcription and mRNA export factor SUS1 (Gene Name=SUS1)

[Back to BioLiP]