Structure of PDB 3k9f Chain D Binding Site BS02

Receptor Information

>3k9f Chain D (length=222) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAK
AKMADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTL
LLTFFYRYMRPLVEAGHVYIALPPLYKMSKKGKKEEVAYAWTDGELEELR
KQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRV
NVLMGDKVEPRRKWIEDNVKFT

Ligand information

>3k9f Chain G (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgtgcat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3k9f Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
Resolution	2.9 Å
Binding residue (original residue number in PDB)	G457 K458 D510
Binding residue (residue number reindexed from 1)	G43 K44 D93

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3k9f, PDBe:3k9f, PDBj:3k9f
PDBsum	3k9f
PubMed	20596531
UniProt	Q59961\|PARE_STRPN DNA topoisomerase 4 subunit B (Gene Name=parE)

[Back to BioLiP]