Structure of PDB 3k48 Chain D Binding Site BS02

Receptor Information
>3k48 Chain D (length=137) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIY
LLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYS
AGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3k48 Multiple novel classes of APRIL-specific receptor-blocking peptides isolated by phage display.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		L161 H163 Y199 L227 S228 S230
Binding residue
(residue number reindexed from 1)		L57 H59 Y95 L123 S124 S126
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0006955 immune response
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3k48, PDBe:3k48, PDBj:3k48
PDBsum3k48
PubMed19945466
UniProtQ9D777|TNF13_MOUSE Tumor necrosis factor ligand superfamily member 13 (Gene Name=Tnfsf13)

[Back to BioLiP]