Structure of PDB 3jct Chain D Binding Site BS02

Receptor Information
>3jct Chain D (length=276) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFT
NKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIA
RRTLQKLGLDEEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGL
YVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSE
LFKGYLADDIDADSLEDIYTSAHEAIRADPAFKPTEKKFTKEQYAAESKK
YRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>3jct Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
.<<<<<<<<....<<<<<<<<.....<<.<<<............>>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jct Diverse roles of assembly factors revealed by structures of late nuclear pre-60S ribosomes
Resolution3.08 Å
Binding residue
(original residue number in PDB)		K8 S10 S14 F16 F20 R21 R22 R24 K27 T28 Y30 R33 R54 N57 K58 D59 Q63 I65 T70 G71 T93 N94 W95 Q151 T155 R158 Y198 V204 Y207 E210 R218 E221 F223 K224 Y226 K258 Y265 E268 S269 Y272 K276 L277 R282 R285
Binding residue
(residue number reindexed from 1)		K2 S4 S8 F10 F14 R15 R16 R18 K21 T22 Y24 R27 R48 N51 K52 D53 Q57 I59 T64 G65 T87 N88 W89 Q130 T134 R137 Y177 V183 Y186 E189 R197 E200 F202 K203 Y205 K237 Y244 E247 S248 Y251 K255 L256 R261 R264
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jct, PDBe:3jct, PDBj:3jct
PDBsum3jct
PubMed27251291
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]