Structure of PDB 3j92 Chain D Binding Site BS02

Receptor Information
>3j92 Chain D (length=292) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMI
VRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTG
LLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLAR
TTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHILGQ
NVADYMRYLIEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPV
YEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERA
Ligand information
>3j92 Chain 7 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j92 Structure and Assembly Pathway of the Ribosome Quality Control Complex.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		K10 F13 K14 Y16 V18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 R58 I61 Q63 E70 G71 D72 M73 I74 Y79 N94 R152 T155 G156 N157 K158 N203 Y207 Y210 Q222 F223 S224 Q225 Y226 Y253 K255 K256 K258 K259 E260 V261 W266 N267 R268 K270 M271 K276 K277 R279 K284
Binding residue
(residue number reindexed from 1)		K8 F11 K12 Y14 V16 F18 R19 R20 R22 T26 Y28 R31 R48 R52 T54 N55 R56 I59 Q61 E68 G69 D70 M71 I72 Y77 N92 R150 T153 G154 N155 K156 N201 Y205 Y208 Q220 F221 S222 Q223 Y224 Y251 K253 K254 K256 K257 E258 V259 W264 N265 R266 K268 M269 K274 K275 R277 K282
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 03:40:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3j92', asym_id = 'D', bs = 'BS02', title = 'Structure and Assembly Pathway of the Ribosome Quality Control Complex.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3j92', asym_id='D', bs='BS02', title='Structure and Assembly Pathway of the Ribosome Quality Control Complex.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '3j92', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='3j92', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>