Structure of PDB 3iwn Chain D Binding Site BS02

Receptor Information
>3iwn Chain D (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>3iwn Chain B (length=93) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacgcacagggcaaaccauucgaaagagugggacgcaaagccuccggccu
aaacggcauugcacuccgccguagguagcgggguuaccgaugg
.<<<......<<...<<<<<<....>>>>>>...>>...<<<.<<<<<<<
..<<<<<..........>>>>>>>>>..>>>>>>...>>.>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3iwn Recognition of the bacterial second messenger cyclic diguanylate by its cognate riboswitch.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Y908 K917 R942 L944 K945 M946 R947 G948 Q949 F951 K983 S986 D987
Binding residue
(residue number reindexed from 1)		Y8 K17 R42 L44 K45 M46 R47 G48 Q49 F51 K83 S86 D87
Binding affinityPDBbind-CN: Kd=1nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3iwn, PDBe:3iwn, PDBj:3iwn
PDBsum3iwn
PubMed19898478
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]