Structure of PDB 3cxc Chain D Binding Site BS02

Receptor Information

>3cxc Chain D (length=140) Species: 2238 (Haloarcula marismortui)

FHEMREPRIEKVVVHMGIGHANAEDILGEITGQMPVRTKAKRTVGEFDIR
EGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGLDVTVNL
VRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV

Ligand information

>3cxc Chain 9 (length=122)

uuaggcggccacagcggugggguugccucccguacccaucccgaacacgg
aagauaagcccaccagcguuccggggaguacuggagugcgcgagccucug
ggaaacccgguucgccgccacc

...<<<<<<....<<<<<<<<......<<<<<<.............>>>>
..>>....>>>>>>.>><..<<<<<.....<<<<<<.<<....>>>>>>>
>....>>>>>.>.>>>>>>...

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3cxc Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): E12 M13 R14 R17 Q47 M48 V50 R51 K72 V73 T74 R76 P137 G138 R140 V141 R144 D145 R149 P152 K154 H155
• Binding residue (residue number reindexed from 1): E3 M4 R5 R8 Q33 M34 V36 R37 K58 V59 T60 R62 P103 G104 R106 V107 R110 D111 R115 P118 K120 H121
• Binding affinity: PDBbind-CN: IC50=4.6uM

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3cxc, PDBe:3cxc, PDBj:3cxc
• PDBsum: 3cxc
• PubMed: 18947996
• UniProt: P14124|RL5_HALMA Large ribosomal subunit protein uL5 (Gene Name=rpl5)