Structure of PDB 3cc4 Chain D Binding Site BS02

Receptor Information
>3cc4 Chain D (length=140) Species: 2238 (Haloarcula marismortui) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FHEMREPRIEKVVVHMGIGHANAEDILGEITGQMPVRTKAKRTVGEFDIR
EGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGLDVTVNL
VRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV
Ligand information
>3cc4 Chain 9 (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuaggcggccacagcggugggguugccucccguacccaucccgaacacgg
aagauaagcccaccagcguuccagggaguacuggagugcgcgagccucug
ggaaauccgguucgccgccacc
...<<<<<<....<<<<<<<<......<<<<<...............>>>
..>>....>>>>>>.>><..<<.<<.....<<<<<<.<<....>>>>>>>
>....>>.>>.>.>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cc4 Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
E12 M13 R14 Q47 M48 V50 V73 T74 R76 P137 G138 R140 V141 K143 R144 D145 R149 P152 K154 H155
Binding residue
(residue number reindexed from 1)
E3 M4 R5 Q33 M34 V36 V59 T60 R62 P103 G104 R106 V107 K109 R110 D111 R115 P118 K120 H121
Binding affinityPDBbind-CN: Kd=100uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3cc4, PDBe:3cc4, PDBj:3cc4
PDBsum3cc4
PubMed18455733
UniProtP14124|RL5_HALMA Large ribosomal subunit protein uL5 (Gene Name=rpl5)

[Back to BioLiP]