Structure of PDB 3a58 Chain D Binding Site BS02

Receptor Information
>3a58 Chain D (length=178) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIRRKLVIVGDGACGKTCLLIVNSKGQFPEVYVPTVFENYVADVEVDGRR
VELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAE
VLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIG
ATGYYECSAKTGYGVREVFEAATRASLM
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain3a58 Chain D Residue 401 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3a58 Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T24 T42
Binding residue
(residue number reindexed from 1)		T17 T35
Annotation score1
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008047 enzyme activator activity
GO:0016787 hydrolase activity
GO:0019901 protein kinase binding
GO:0031681 G-protein beta-subunit binding
Biological Process
GO:0006075 (1->3)-beta-D-glucan biosynthetic process
GO:0007015 actin filament organization
GO:0007117 budding cell bud growth
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0008361 regulation of cell size
GO:0009272 fungal-type cell wall biogenesis
GO:0030036 actin cytoskeleton organization
GO:0030476 ascospore wall assembly
GO:0032186 cellular bud neck septin ring organization
GO:0032880 regulation of protein localization
GO:0032889 regulation of vacuole fusion, non-autophagic
GO:0032956 regulation of actin cytoskeleton organization
GO:0045807 positive regulation of endocytosis
GO:0060178 regulation of exocyst localization
GO:0060237 regulation of fungal-type cell wall organization
GO:0090037 positive regulation of protein kinase C signaling
GO:0090334 regulation of cell wall (1->3)-beta-D-glucan biosynthetic process
GO:1903395 regulation of secondary cell septum biogenesis
GO:1903501 positive regulation of mitotic actomyosin contractile ring assembly
Cellular Component
GO:0000131 incipient cellular bud site
GO:0000148 1,3-beta-D-glucan synthase complex
GO:0000329 fungal-type vacuole membrane
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005768 endosome
GO:0005777 peroxisome
GO:0005778 peroxisomal membrane
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005933 cellular bud
GO:0005934 cellular bud tip
GO:0005935 cellular bud neck
GO:0009277 fungal-type cell wall
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0031160 spore wall
GO:0043332 mating projection tip
GO:0071944 cell periphery

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3a58, PDBe:3a58, PDBj:3a58
PDBsum3a58
PubMed20062059
UniProtP06780|RHO1_YEAST GTP-binding protein RHO1 (Gene Name=RHO1)

[Back to BioLiP]