Structure of PDB 2xo6 Chain D Binding Site BS02

Receptor Information
>2xo6 Chain D (length=128) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEV
ITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWG
GNLWNPSYCILTVSENTRAQIQKFIESQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xo6 DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K29 Y30 P81 K85 K88 G89 A90 A92 R93 R94 G109 N110 L111 W112 N113 P114 S115 Y116
Binding residue
(residue number reindexed from 1)		K21 Y22 P73 K77 K80 G81 A82 A84 R85 R86 G101 N102 L103 W104 N105 P106 S107 Y108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004803 transposase activity
GO:0046872 metal ion binding
Biological Process
GO:0006310 DNA recombination
GO:0006313 DNA transposition
GO:0032196 transposition

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xo6, PDBe:2xo6, PDBj:2xo6
PDBsum2xo6
PubMed20890269
UniProtQ7DF83|DRA2A_DEIRA ISDra2 transposase TnpA (Gene Name=tnpA)

[Back to BioLiP]