Structure of PDB 2rkz Chain D Binding Site BS02

Receptor Information
>2rkz Chain D (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCH
EGGQSYKIGDTWRRPHYMLECVCLGNGKGEWTCKPI
Ligand information
>2rkz Chain P (length=21) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ETLTGQYDKNLVTTVEEEYDS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rkz Crystal structures of fibronectin-binding sites from Staphylococcus aureus FnBPA in complex with fibronectin domains
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R83 R99 G100 R101 I102 S103 C104 T105 I106 R109 H111 K143 G144 E145 W146 T147 C148
Binding residue
(residue number reindexed from 1)		R22 R38 G39 R40 I41 S42 C43 T44 I45 R48 H50 K78 G79 E80 W81 T82 C83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:2rkz, PDBe:2rkz, PDBj:2rkz
PDBsum2rkz
PubMed18713862
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]