Structure of PDB 2qa4 Chain D Binding Site BS02

Receptor Information

>2qa4 Chain D (length=140) Species: 2238 (Haloarcula marismortui)

FHEMREPRIEKVVVHMGIGHANAEDILGEITGQMPVRTKAKRTVGEFDIR
EGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGLDVTVNL
VRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV

Ligand information

>2qa4 Chain 9 (length=122)

uuaggcggccacagcggugggguugccucccguacccaucccgaacacgg
aagauaagcccaccagcguuccggggaguacuggagugcgcgagccucug
ggaaacccgguucgccgccacc

...<<<<<<....<<<<<<<<......<<<<<<.............>>>>
..>>....>>>>>>.>><..<<<<<.....<<<<<<.<<....>>>>>>>
>....>>>>>.>.>>>>>>...

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2qa4 Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): M13 Q47 M48 P49 V50 K72 V73 T74 R76 P137 R140 V141 R149 P152 K154 H155
• Binding residue (residue number reindexed from 1): M4 Q33 M34 P35 V36 K58 V59 T60 R62 P103 R106 V107 R115 P118 K120 H121

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2qa4, PDBe:2qa4, PDBj:2qa4
• PDBsum: 2qa4
• PubMed: 17599351
• UniProt: P14124|RL5_HALMA Large ribosomal subunit protein uL5 (Gene Name=rpl5)