Structure of PDB 2hap Chain D Binding Site BS02

Receptor Information
>2hap Chain D (length=75) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRNRIPLRCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAE
KELLKDNELKKLRERVKSLEKTLSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hap Structure of HAP1-18-DNA implicates direct allosteric effect of protein-DNA interactions on transcriptional activation.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R57 R59 R63 K71 V72 K73
Binding residue
(residue number reindexed from 1)		R2 R4 R8 K16 V17 K18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2hap, PDBe:2hap, PDBj:2hap
PDBsum2hap
PubMed9886287
UniProtP0CS82|HAP1_YEASX Heme-responsive zinc finger transcription factor HAP1 (Gene Name=HAP1)

[Back to BioLiP]