Structure of PDB 2d45 Chain D Binding Site BS02

Receptor Information
>2d45 Chain D (length=115) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKG
FIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKE
DLSQDEIEELRNILN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2d45 Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec.
Resolution3.8 Å
Binding residue
(original residue number in PDB)
S9 A11 W40 S41 T44 T47
Binding residue
(residue number reindexed from 1)
S3 A5 W34 S35 T38 T41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2d45, PDBe:2d45, PDBj:2d45
PDBsum2d45
PubMed16582476
UniProtP68261|MECI_STAAN Methicillin resistance regulatory protein MecI (Gene Name=mecI)

[Back to BioLiP]