Structure of PDB 2b5l Chain D Binding Site BS02

Receptor Information

>2b5l Chain D (length=175)

KLIETGLNTVEYFTSQQVTGTSSLGKNTIPPGVTGLLTNARPKIAIVPAD
DKTVPGKPIPNPLLGLDSTPSTQTVLDLSGKTLPSGSYKGVKLAKFGKEN
LMTRFIEEPREIDFKRGRDTGGFHRREYSIGWVGDEVKVTEWCNPSCSPI
TAAARRFECTCHQCPVTCSECERDT

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 2b5l Chain D Residue 3004

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2b5l Structure of DDB1 in complex with a paramyxovirus V protein: viral hijack of a propeller cluster in ubiquitin ligase.
• Resolution: 2.85 Å
• Binding residue (original residue number in PDB): C190 C215 C218
• Binding residue (residue number reindexed from 1): C143 C168 C171
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0046872 metal ion binding
• GO:1990756 ubiquitin-like ligase-substrate adaptor activity

Biological Process

• GO:0019049 virus-mediated perturbation of host defense response
• GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
• GO:0039554 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MDA-5 activity
• GO:0039563 symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT1 activity
• GO:0039564 symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT2 activity
• GO:0044068 symbiont-mediated perturbation of host cellular process

Cellular Component

• GO:0030430 host cell cytoplasm

External links

• PDB: RCSB:2b5l, PDBe:2b5l, PDBj:2b5l
• PDBsum: 2b5l
• PubMed: 16413485
• UniProt: P11207|V_PIV5 Non-structural protein V (Gene Name=P/V)