Structure of PDB 2b3j Chain D Binding Site BS02

Receptor Information

>2b3j Chain D (length=150) Species: 158878 (Staphylococcus aureus subsp. aureus Mu50)

NDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTA
HAEHIAIERAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGA
DDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLLTTFFKNLRANK

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 2b3j Chain D Residue 2004

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2b3j Crystal structure of Staphylococcus aureus tRNA adenosine deaminase TadA in complex with RNA.
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): H53 C83 C86
• Binding residue (residue number reindexed from 1): H51 C81 C84
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): H53 C83 C86
• Catalytic site (residue number reindexed from 1): H51 C81 C84
• Enzyme Commision number: 3.5.4.33: tRNA(adenine(34)) deaminase.

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008251 tRNA-specific adenosine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding
• GO:0052717 tRNA-specific adenosine-34 deaminase activity

Biological Process

• GO:0002100 tRNA wobble adenosine to inosine editing
• GO:0008033 tRNA processing

External links

• PDB: RCSB:2b3j, PDBe:2b3j, PDBj:2b3j
• PDBsum: 2b3j
• PubMed: 16415880
• UniProt: Q99W51|TADA_STAAM tRNA-specific adenosine deaminase (Gene Name=tadA)