Structure of PDB 2ac0 Chain D Binding Site BS02

Receptor Information

>2ac0 Chain D (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQL
WVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLI
RVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGG
MNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG

Ligand information

>2ac0 Chain H (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgggcatgcccg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ac0 Structural Basis of DNA Recognition by p53 Tetramers
Resolution	1.8 Å
Binding residue (original residue number in PDB)	S241 R248 R273 C275 A276 R280
Binding residue (residue number reindexed from 1)	S146 R153 R178 C180 A181 R185
Binding affinity	PDBbind-CN: Kd=25nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2ac0, PDBe:2ac0, PDBj:2ac0
PDBsum	2ac0
PubMed	16793544
UniProt	P04637\|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53)

[Back to BioLiP]