Structure of PDB 1zme Chain D Binding Site BS02

Receptor Information
>1zme Chain D (length=70) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQ
KDLNDKTEENNRLKALLLER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zme Crystal structure of a PUT3-DNA complex reveals a novel mechanism for DNA recognition by a protein containing a Zn2Cys6 binuclear cluster.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R40 H41 K68 I69 V70 S72 Y75
Binding residue
(residue number reindexed from 1)		R10 H11 K38 I39 V40 S42 Y45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1zme, PDBe:1zme, PDBj:1zme
PDBsum1zme
PubMed9303004
UniProtP25502|PUT3_YEAST Proline utilization trans-activator (Gene Name=PUT3)

[Back to BioLiP]