Structure of PDB 1ysh Chain D Binding Site BS02

Receptor Information
>1ysh Chain D (length=73) Species: 4530 (Oryza sativa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKD
CGKVKAGGAYTMNTASAVTVRST
Ligand information
>1ysh Chain F (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caacuccguggaagccguaauggcaggaagcgga
....<<<<<....<<<<...>>>>.....>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ysh Localization and dynamic behavior of ribosomal protein L30e
Resolution9.5 Å
Binding residue
(original residue number in PDB)		C42 C60
Binding residue
(residue number reindexed from 1)		C33 C51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ysh, PDBe:1ysh, PDBj:1ysh
PDBsum1ysh
PubMed15864315
UniProtP0DKK1|RL371_ORYSJ Large ribosomal subunit protein eL43z (Gene Name=Os01g0679700)

[Back to BioLiP]