Structure of PDB 1ysa Chain D Binding Site BS02

Receptor Information
>1ysa Chain D (length=57) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVAR
LKKLVGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ysa The GCN4 basic region leucine zipper binds DNA as a dimer of uninterrupted alpha helices: crystal structure of the protein-DNA complex.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R232 T236 R240 R243
Binding residue
(residue number reindexed from 1)		R9 T13 R17 R20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ysa, PDBe:1ysa, PDBj:1ysa
PDBsum1ysa
PubMed1473154
UniProtP03069|GCN4_YEAST General control transcription factor GCN4 (Gene Name=GCN4)

[Back to BioLiP]