Structure of PDB 1ux1 Chain D Binding Site BS02

Receptor Information

>1ux1 Chain D (length=131) Species: 1423 (Bacillus subtilis)

MNRQELITEALKARDMAYAPYSKFQVGAALLTKDGKVYRGCNIENAAYSM
CNHAEQTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELCTKD
VIVVLTNLQGQIKEMTVEELLPGAFSSEDLH

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1ux1 Chain D Residue 1132

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1ux1 Structural, Kinetic, and Mutational Studies of the Zinc Ion Environment in Tetrameric Cytidine Deaminase
• Resolution: 2.36 Å
• Binding residue (original residue number in PDB): H53 C86 C89
• Binding residue (residue number reindexed from 1): H53 C86 C89
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 3.5.4.5: cytidine deaminase.

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004126 cytidine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009972 cytidine deamination
• GO:0055086 nucleobase-containing small molecule metabolic process
• GO:0072527 pyrimidine-containing compound metabolic process
• GO:1901135 carbohydrate derivative metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1ux1, PDBe:1ux1, PDBj:1ux1
• PDBsum: 1ux1
• PubMed: 15147186
• UniProt: P19079|CDD_BACSU Cytidine deaminase (Gene Name=cdd)