Structure of PDB 1tf6 Chain D Binding Site BS02

Receptor Information
>1tf6 Chain D (length=182) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVVYKRYICSFADCGAAYNKNWKLQAHLCKHTGEKPFPCKEEGCEKGFTS
LHHLTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIKICVYV
CHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHE
KVHAGYPCKKDDSCSFVGKTWTLYLKHVAECH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tf6 Differing roles for zinc fingers in DNA recognition: structure of a six-finger transcription factor IIIA complex.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
Y10 R12 Y13 K26 W28 H58 K87 A88 K92 L148 S150
Binding residue
(residue number reindexed from 1)
Y4 R6 Y7 K20 W22 H52 K81 A82 K86 L142 S144
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1tf6, PDBe:1tf6, PDBj:1tf6
PDBsum1tf6
PubMed9501194
UniProtP03001|TF3A_XENLA Transcription factor IIIA (Gene Name=gtf3a)

[Back to BioLiP]