Structure of PDB 1s32 Chain D Binding Site BS02

Receptor Information
>1s32 Chain D (length=101) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIA
GEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
K
Ligand information
>1s32 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1s32 Molecular Recognition of the Nucleosomal 'Supergroove'
Resolution2.05 Å
Binding residue
(original residue number in PDB)		K1224 R1226 K1228 R1230 K1231 E1232 S1233 I1236 Y1237
Binding residue
(residue number reindexed from 1)		K3 R5 K7 R9 K10 E11 S12 I15 Y16
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1s32, PDBe:1s32, PDBj:1s32
PDBsum1s32
PubMed15100411
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]