Structure of PDB 1rz9 Chain D Binding Site BS02

Receptor Information
>1rz9 Chain D (length=193) Species: 82300 (adeno-associated virus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MATFYEVIVRVPFDVEEHLPGISDSFVDWVTGQIWELPPESDLNLTLVEQ
PQLTVADRIRRVFLYEWNKFSKQESKFFVQFEKGSEYFHLHTLVETSGIS
SMVLGRYVSQIRAQLVKVVFQGIEPQINDWVAITKVKKGGANKVVDSGYI
PAYLLPKVQPELQWAWTNLDEYKLAALNLEERKRLVAQFLAES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rz9 The nuclease domain of adeno-associated virus rep coordinates replication initiation using two distinct DNA recognition interfaces.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
S101 M102 G105 K135 G139 A141 N142
Binding residue
(residue number reindexed from 1)
S101 M102 G105 K135 G139 A141 N142
Enzymatic activity
Enzyme Commision number ?
External links