Structure of PDB 1r71 Chain D Binding Site BS02

Receptor Information
>1r71 Chain D (length=115) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NEADQVIENLQRNELTPREIADFIGRELAKGKKKGDIAKEIGKSPAFITQ
HVTLLDLPEKIADAFNTGRVRDVTVVNELVTAFKKRPEEVEAWLDDDTQE
ITRGTVKLLREFLDE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r71 Sequence-specific DNA binding determined by contacts outside the helix-turn-helix motif of the ParB homolog KorB.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
K171 G172 P182 T186 R247
Binding residue
(residue number reindexed from 1)
K34 G35 P45 T49 R110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1r71, PDBe:1r71, PDBj:1r71
PDBsum1r71
PubMed15170177
UniProtP07674|KORB2_ECOLX Transcriptional repressor protein KorB (Gene Name=korB)

[Back to BioLiP]