Structure of PDB 1qp9 Chain D Binding Site BS02

Receptor Information

>1qp9 Chain D (length=75) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RKRNRIPLGCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEA
EKELLKDNELKKLRERVKSLEKTLS

Ligand information

>1qp9 Chain H (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

taatagcgataatagcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1qp9 Structure of HAP1-PC7 bound to DNA: implications for DNA recognition and allosteric effects of DNA-binding on transcriptional activation.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	K56 R57 R59 P61 K71 V72 K73
Binding residue (residue number reindexed from 1)	K2 R3 R5 P7 K17 V18 K19
Binding affinity	PDBbind-CN: Kd=37.8nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1qp9, PDBe:1qp9, PDBj:1qp9
PDBsum	1qp9
PubMed	11024163
UniProt	P0CS82\|HAP1_YEASX Heme-responsive zinc finger transcription factor HAP1 (Gene Name=HAP1)

[Back to BioLiP]