Structure of PDB 1nkp Chain D Binding Site BS02

Receptor Information

>1nkp Chain D (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MNVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATA
YILSVQAEEQKLISEEDLLRKRREQLKHKLEQL

Ligand information

>1nkp Chain J (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgagtagcacgtgctactc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1nkp X-ray structures of Myc-Max and Mad-Max recognizing DNA: Molecular bases of regulation by proto-oncogenic transcription factors
Resolution	1.8 Å
Binding residue (original residue number in PDB)	K502 E510 R513
Binding residue (residue number reindexed from 1)	K4 E12 R15
Binding affinity	PDBbind-CN: Kd=90nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0046983	protein dimerization activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1nkp, PDBe:1nkp, PDBj:1nkp
PDBsum	1nkp
PubMed	12553908
UniProt	P01106\|MYC_HUMAN Myc proto-oncogene protein (Gene Name=MYC)

[Back to BioLiP]