Structure of PDB 1mow Chain D Binding Site BS02

Receptor Information
>1mow Chain D (length=248) Species: 2275,3055 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIWGDGGLYKLKYKGNRSEYRVVITQKSENLIKQFIAP
RMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNGN
RFLAYLAGIVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTERRWFLDK
LVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLNFKQKQANLVLK
IIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLDSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mow Design, Activity and Structure of a Highly Specific Artificial Endonuclease
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D521 N532 R533 S534 E535 Y536 R537 S567 K568 Q570 D575 R581 S583 S584 K585 G616 D617 G618 S619 I621 Q623 N627 Q641 T643 Q644 K645 R667 K695 N733 D734 S735 R738 K739
Binding residue
(residue number reindexed from 1)		D17 N28 R29 S30 E31 Y32 R33 S63 K64 Q66 D71 R77 S79 S80 K81 G112 D113 G114 S115 I117 Q119 N123 Q137 T139 Q140 K141 R163 K191 N229 D230 S231 R234 K235
Enzymatic activity
Catalytic site (original residue number in PDB) G616 D617
Catalytic site (residue number reindexed from 1) G112 D113
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mow, PDBe:1mow, PDBj:1mow
PDBsum1mow
PubMed12419232
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI;
P21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]