Structure of PDB 1kc6 Chain D Binding Site BS02

Receptor Information

>1kc6 Chain D (length=236) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SFIKPIYQDINSILIGQKGEPFEKLVYKFLKENLSDLTFKQYEYLNDLFM
KNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQNDTADI
LLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAKMIDNKEFDLFD
INYLEVDWLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLDQGFNG
TREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI

Ligand information

>1kc6 Chain H (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccggtcgaccgg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1kc6 Sequence selectivity and degeneracy of a restriction endonuclease mediated by DNA intercalation.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	Q109 Q138 Y199 N201 A203 A204
Binding residue (residue number reindexed from 1)	Q94 Q123 Y178 N180 A182 A183

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1kc6, PDBe:1kc6, PDBj:1kc6
PDBsum	1kc6
PubMed	11742344
UniProt	P17743\|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]