Structure of PDB 1hdd Chain D Binding Site BS02

Receptor Information
>1hdd Chain D (length=57) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNK
RAKIKKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hdd Crystal structure of an engrailed homeodomain-DNA complex at 2.8 A resolution: a framework for understanding homeodomain-DNA interactions.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R3 Q44 N51
Binding residue
(residue number reindexed from 1)		R1 Q42 N49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hdd, PDBe:1hdd, PDBj:1hdd
PDBsum1hdd
PubMed1977522
UniProtP02836|HMEN_DROME Segmentation polarity homeobox protein engrailed (Gene Name=en)

[Back to BioLiP]