Structure of PDB 1gxc Chain D Binding Site BS02

Receptor Information
>1gxc Chain D (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSK
KHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIAL
SLSRNKVFVFFDLTVD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gxc Structural and Functional Versatility of the Fha Domain in DNA-Damage Signaling by the Tumor Suppressor Kinase Chk2
Resolution2.7 Å
Binding residue
(original residue number in PDB)
R117 D118 K119 Y136 R137 T138 Y139 S140 K141 N166 S192
Binding residue
(residue number reindexed from 1)
R26 D27 K28 Y45 R46 T47 Y48 S49 K50 N75 S101
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
External links
PDB RCSB:1gxc, PDBe:1gxc, PDBj:1gxc
PDBsum1gxc
PubMed12049740
UniProtO96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 (Gene Name=CHEK2)

[Back to BioLiP]