Structure of PDB 1g5q Chain D Binding Site BS02

Receptor Information
>1g5q Chain D (length=174) Species: 1282 (Staphylococcus epidermidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYGKLLICATASINVININHYIVELKQHFDEVNILFSPSSKNFINTDVLK
LFCDNLYDEIKDPLLNNINIVENHEYILVLPASANTINKIANGICDNLLT
TVCLTGYQKLFIFPNMNIRMWGNPFLQKNIDLLKNNDVKVYSPDMNKSFE
ISSGRYKNNITMPNIENVLNFVLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g5q Crystal structure of the peptidyl-cysteine decarboxylase EpiD complexed with a pentapeptide substrate.
Resolution2.57 Å
Binding residue
(original residue number in PDB)		N14 N117 S148 F149 E150 I151 S152 N159 T161 M162
Binding residue
(residue number reindexed from 1)		N14 N117 S148 F149 E150 I151 S152 N159 T161 M162
Enzymatic activity
Catalytic site (original residue number in PDB) N67
Catalytic site (residue number reindexed from 1) N67
Enzyme Commision number 4.1.1.-
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004633 phosphopantothenoylcysteine decarboxylase activity
GO:0010181 FMN binding
GO:0016829 lyase activity
Biological Process
GO:0015937 coenzyme A biosynthetic process
Cellular Component
GO:0071513 phosphopantothenoylcysteine decarboxylase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1g5q, PDBe:1g5q, PDBj:1g5q
PDBsum1g5q
PubMed11101502
UniProtP30197|EPID_STAEP Epidermin decarboxylase (Gene Name=epiD)

[Back to BioLiP]