Structure of PDB 1f5t Chain D Binding Site BS02

Receptor Information
>1f5t Chain D (length=120) Species: 1717 (Corynebacterium diphtheriae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERD
GLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEA
DRWEHVMSDEVERRLVKVLK
Ligand information
>1f5t Chain F (length=43) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttaacatgcaaggctaaggttaggctaaccttagccttgcatg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f5t Methyl groups of thymine bases are important for nucleic acid recognition by DtxR.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K4002 T4007 Q4036 S4037 P4039 T4040 Q4043 R4047 R4050
Binding residue
(residue number reindexed from 1)		K1 T6 Q35 S36 P38 T39 Q42 R46 R49
Binding affinityPDBbind-CN: Kd=460nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1f5t, PDBe:1f5t, PDBj:1f5t
PDBsum1f5t
PubMed10956029
UniProtP0DJL7|DTXR_CORDI Diphtheria toxin repressor (Gene Name=dtxR)

[Back to BioLiP]