Structure of PDB 1dlk Chain D Binding Site BS02

Receptor Information
>1dlk Chain D (length=230) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDV
VVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFS
QTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSN
TNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSW
GSSTCSTSTPGVYARVTALVNWVQQTLAAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dlk Crystal structure of delta-chymotrypsin bound to a peptidyl chloromethyl ketone inhibitor.
Resolution2.14 Å
Binding residue
(original residue number in PDB)		H57 L97 T98 K175 S190 M192 S195 S214 W215 G216 S217
Binding residue
(residue number reindexed from 1)		H42 L82 T83 K160 S175 M177 S180 S199 W200 G201 S202
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 M192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H42 D87 M177 G178 D179 S180 G181
Enzyme Commision number 3.4.21.1: chymotrypsin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008236 serine-type peptidase activity
GO:0097655 serpin family protein binding
Biological Process
GO:0006508 proteolysis
GO:0007586 digestion
Cellular Component
GO:0005576 extracellular region
GO:0097180 serine protease inhibitor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1dlk, PDBe:1dlk, PDBj:1dlk
PDBsum1dlk
PubMed10713514
UniProtP00766|CTRA_BOVIN Chymotrypsinogen A

[Back to BioLiP]