Structure of PDB 1by4 Chain D Binding Site BS02

Receptor Information
>1by4 Chain D (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCL
IDKRQRNRCQYCRYQKCLAMGMKREAVQEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1by4 Structural basis of RXR-DNA interactions.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		E2253 G2254 F2258 R2261 R2284 N2285 Q2288 R2291
Binding residue
(residue number reindexed from 1)		E25 G26 F30 R33 R56 N57 Q60 R63
Binding affinityPDBbind-CN: Kd=350nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1by4, PDBe:1by4, PDBj:1by4
PDBsum1by4
PubMed10669605
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]