Structure of PDB 1apl Chain D Binding Site BS02

Receptor Information
>1apl Chain D (length=58) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVS
NRRRKEKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1apl Crystal structure of a MAT alpha 2 homeodomain-operator complex suggests a general model for homeodomain-DNA interactions.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R132 G133 H134 R135 F136 Q175 N182 K186
Binding residue
(residue number reindexed from 1)		R1 G2 H3 R4 F5 Q44 N51 K55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1apl, PDBe:1apl, PDBj:1apl
PDBsum1apl
PubMed1682054
UniProtP0CY08|MTAL2_YEAST Mating-type protein ALPHA2 (Gene Name=MATALPHA2)

[Back to BioLiP]