Structure of PDB 7pub Chain Cn Binding Site BS02

Receptor Information
>7pub Chain Cn (length=62) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQVTFGPRNYPYPSSRWLARRFQMKKHRIIKRFRFRRYKLAAVANLPFAK
MIRVGMLPELKS
Ligand information
>7pub Chain UG (length=13) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pub Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		F169 F180
Binding residue
(residue number reindexed from 1)		F22 F33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005739 mitochondrion
GO:0020023 kinetoplast

View graph for
Cellular Component
External links
PDB RCSB:7pub, PDBe:7pub, PDBj:7pub
PDBsum7pub
PubMed35042777
UniProtQ57VQ9

[Back to BioLiP]