Structure of PDB 8jiv Chain Cl Binding Site BS02

Receptor Information
>8jiv Chain Cl (length=50) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSHKTFRIKQKLAKKQRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLGF
Ligand information
>8jiv Chain Ac (length=152) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucucggcaacggauaucucggcucucgcaucgaugaagaacguagc
gaaaugcgauaccuggugugaauugcagaauccgugaaccaucgagucuu
ugaacgcaaguugcgcccgaggggccgagggcacgccugccugggcguca
cg
.........................................<<<<<<.((
.....>>>....<<<<<<......)).............>>>>.>>..>>
>....<<.....>><<<<..<<..>>..>>>>..................
..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
Resolution2.84 Å
Binding residue
(original residue number in PDB)		F7 R8 Q11 K12 K15 Q19 R21 I23 P24 W26 I27 M29 R30 T31 I35
Binding residue
(residue number reindexed from 1)		F6 R7 Q10 K11 K14 Q18 R20 I22 P23 W25 I26 M28 R29 T30 I34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum8jiv
PubMed38458197
UniProtQ5I7K7

[Back to BioLiP]