Structure of PDB 4v7e Chain Cl Binding Site BS02

Receptor Information
>4v7e Chain Cl (length=51) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPSHKTFRIKQKLAKKQRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLG
F
Ligand information
>4v7e Chain Ac (length=160) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucucggcaacggauaucucggcucucgcaucgaugaagaacguagc
gaaaugcgauaccuggugugaauugcagaaucccgugaaccaucgagucu
uugaacgcaaguugcgcccgaggccauccggccgagggcacgccugccug
ggcgucacgc
.........................................<<<<<<.<<
.....>>>....((.<<<......>>..............>>>..))..>
>>....<<.....>><<<<..<<<<....>>>>..>>>>...........
..........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
Resolution5.5 Å
Binding residue
(original residue number in PDB)		H4 K5 T6 F7 R8 Q11 K12 K15 R18 R21 P22 I23 P24 W26 I27 R30
Binding residue
(residue number reindexed from 1)		H4 K5 T6 F7 R8 Q11 K12 K15 R18 R21 P22 I23 P24 W26 I27 R30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7e, PDBe:4v7e, PDBj:4v7e
PDBsum4v7e
PubMed24499919
UniProtQ5I7K7

[Back to BioLiP]