Structure of PDB 8jiv Chain Cj Binding Site BS02

Receptor Information

>8jiv Chain Cj (length=86) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSV
KAIRRKTTGTGRMRYMRHVPRRFKSNFREGTEAAPR

Ligand information

>8jiv Chain Ac (length=152) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgacucucggcaacggauaucucggcucucgcaucgaugaagaacguagc
gaaaugcgauaccuggugugaauugcagaauccgugaaccaucgagucuu
ugaacgcaaguugcgcccgaggggccgagggcacgccugccugggcguca
cg

.........................................<<<<<<.((
.....>>>....<<<<<<......)).............>>>>.>>..>>
>....<<.....>><<<<..<<..>>..>>>>..................
..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
Resolution	2.84 Å
Binding residue (original residue number in PDB)	R21 C22 G23 L29 A42 T59 G62 R63 M64 R65 Y66 M67 R68 V70 R72 F74 S76 R79 E80 T82 E83 A84 R87
Binding residue (residue number reindexed from 1)	R20 C21 G22 L28 A41 T58 G61 R62 M63 R64 Y65 M66 R67 V69 R71 F73 S75 R78 E79 T81 E82 A83 R86

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum	8jiv
PubMed	38458197
UniProt	A0A1D6BC85

[Back to BioLiP]