Structure of PDB 8jiv Chain Ch Binding Site BS02

Receptor Information
>8jiv Chain Ch (length=116) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKAGELWNKSKDDLTKQLAELKTELGQLRIQKVASSGSKLNRIHDIRKSI
ARVLTVINAKQRAQLRLFYKKYAPLDLRAKQTRAIRRRLSPDEKSRVLEK
TKKRTVHFPQRKFAIK
Ligand information
>8jiv Chain Ac (length=152) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucucggcaacggauaucucggcucucgcaucgaugaagaacguagc
gaaaugcgauaccuggugugaauugcagaauccgugaaccaucgagucuu
ugaacgcaaguugcgcccgaggggccgagggcacgccugccugggcguca
cg
.........................................<<<<<<.((
.....>>>....<<<<<<......)).............>>>>.>>..>>
>....<<.....>><<<<..<<..>>..>>>>..................
..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
Resolution2.84 Å
Binding residue
(original residue number in PDB)
K7 W12 K37 N46 R52 A56 R57 L59 T60 N63 R67 R71 K87 T89 R90 R93
Binding residue
(residue number reindexed from 1)
K2 W7 K32 N41 R47 A51 R52 L54 T55 N58 R62 R66 K80 T82 R83 R86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum8jiv
PubMed38458197
UniProtQ8L805|RL35_WHEAT Large ribosomal subunit protein uL29 (Gene Name=RPL35)

[Back to BioLiP]