Structure of PDB 4v7e Chain Ch Binding Site BS02

Receptor Information
>4v7e Chain Ch (length=124) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSSGKVKAGELWNKSKDDLTKQLAELKTELGQLRIQKVASSGSKLNRIHD
IRKSIARVLTVINAKQRAQLRLFYKNKKYAPLDLRAKQTRAIRRRLSPDE
KSRVLEKTKKRTVHFPQRKFAIKA
Ligand information
>4v7e Chain Ac (length=160) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucucggcaacggauaucucggcucucgcaucgaugaagaacguagc
gaaaugcgauaccuggugugaauugcagaaucccgugaaccaucgagucu
uugaacgcaaguugcgcccgaggccauccggccgagggcacgccugccug
ggcgucacgc
.........................................<<<<<<.<<
.....>>>....((.<<<......>>..............>>>..))..>
>>....<<.....>><<<<..<<<<....>>>>..>>>>...........
..........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
Resolution5.5 Å
Binding residue
(original residue number in PDB)
S2 S3 K7 A8 G9 W12 K37 K44 L45 I48 R52 K53 I55 A56 R57 L59 T60 R67 L84 R85 T89 R90 I92 R93
Binding residue
(residue number reindexed from 1)
S2 S3 K7 A8 G9 W12 K37 K44 L45 I48 R52 K53 I55 A56 R57 L59 T60 R67 L84 R85 T89 R90 I92 R93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v7e, PDBe:4v7e, PDBj:4v7e
PDBsum4v7e
PubMed24499919
UniProtQ8L805|RL35_WHEAT Large ribosomal subunit protein uL29 (Gene Name=RPL35)

[Back to BioLiP]