Structure of PDB 4v7e Chain Ch Binding Site BS02

Receptor Information

>4v7e Chain Ch (length=124) Species: 4565 (Triticum aestivum)

MSSGKVKAGELWNKSKDDLTKQLAELKTELGQLRIQKVASSGSKLNRIHD
IRKSIARVLTVINAKQRAQLRLFYKNKKYAPLDLRAKQTRAIRRRLSPDE
KSRVLEKTKKRTVHFPQRKFAIKA

Ligand information

>4v7e Chain Ac (length=160)

cgacucucggcaacggauaucucggcucucgcaucgaugaagaacguagc
gaaaugcgauaccuggugugaauugcagaaucccgugaaccaucgagucu
uugaacgcaaguugcgcccgaggccauccggccgagggcacgccugccug
ggcgucacgc

.........................................<<<<<<.<<
.....>>>....((.<<<......>>..............>>>..))..>
>>....<<.....>><<<<..<<<<....>>>>..>>>>...........
..........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
• Resolution: 5.5 Å
• Binding residue (original residue number in PDB): S2 S3 K7 A8 G9 W12 K37 K44 L45 I48 R52 K53 I55 A56 R57 L59 T60 R67 L84 R85 T89 R90 I92 R93
• Binding residue (residue number reindexed from 1): S2 S3 K7 A8 G9 W12 K37 K44 L45 I48 R52 K53 I55 A56 R57 L59 T60 R67 L84 R85 T89 R90 I92 R93

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7e, PDBe:4v7e, PDBj:4v7e
• PDBsum: 4v7e
• PubMed: 24499919
• UniProt: Q8L805|RL35_WHEAT Large ribosomal subunit protein uL29 (Gene Name=RPL35)