Structure of PDB 4v7e Chain CX Binding Site BS02

Receptor Information
>4v7e Chain CX (length=122) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKSKKIRTSVTFHRPKTLKKARDPKYPRVSAPGRNKLDQYQILKYPLTTE
SAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIRPDGKK
KAYVKLTPDYDALDVANKIGII
Ligand information
>4v7e Chain Ac (length=160) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucucggcaacggauaucucggcucucgcaucgaugaagaacguagc
gaaaugcgauaccuggugugaauugcagaaucccgugaaccaucgagucu
uugaacgcaaguugcgcccgaggccauccggccgagggcacgccugccug
ggcgucacgc
.........................................<<<<<<.<<
.....>>>....((.<<<......>>..............>>>..))..>
>>....<<.....>><<<<..<<<<....>>>>..>>>>...........
..........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
Resolution5.5 Å
Binding residue
(original residue number in PDB)		K32 K34 R37 R52 P54 R64 D68 Q69 Y70 D97 L98 K99 K103 D127 K129 K130
Binding residue
(residue number reindexed from 1)		K2 K4 R7 R22 P24 R34 D38 Q39 Y40 D67 L68 K69 K73 D97 K99 K100
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Mar 10 10:33:21 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v7e', asym_id = 'CX', bs = 'BS02', title = 'Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v7e', asym_id='CX', bs='BS02', title='Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v7e', asym_id = 'CX'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v7e', asym_id='CX')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>