Structure of PDB 4v6w Chain CX Binding Site BS02

Receptor Information
>4v6w Chain CX (length=120) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYPLTTEAA
MKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIRPDGQKKA
YVRLARDYDALDIANKIGII
Ligand information
>4v6w Chain A9 (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcuuggacuacauaugguugaggguugua
..............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6w Structures of the human and Drosophila 80S ribosome.
Resolution6.0 Å
Binding residue
(original residue number in PDB)		R159 P170 T172 L173 L175 R177 R183 K184 T188 N190 N228 H229
Binding residue
(residue number reindexed from 1)		R2 P13 T15 L16 L18 R20 R26 K27 T31 N33 N71 H72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6w, PDBe:4v6w, PDBj:4v6w
PDBsum4v6w
PubMed23636399
UniProtQ9W0A8

[Back to BioLiP]