Structure of PDB 4v9q Chain CO Binding Site BS02

Receptor Information
>4v9q Chain CO (length=98) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG
Ligand information
>4v9q Chain CB (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg
.<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v9q Blasticidin S inhibits translation by trapping deformed tRNA on the ribosome.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R15 K19 R25 F29 R30 S31 L32 H34 Y36 Q38 V46 T47 S50 S52 A55 G60 N61 K62 T63 Y92 K93 H95 R97
Binding residue
(residue number reindexed from 1)		R5 K9 R15 F19 R20 S21 L22 H24 Y26 Q28 V36 T37 S40 S42 A45 G50 N51 K52 T53 Y82 K83 H85 R87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9q, PDBe:4v9q, PDBj:4v9q
PDBsum4v9q
PubMed23824292
UniProtQ72I20|RL18_THET2 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]