Structure of PDB 8k82 Chain CN Binding Site BS02

Receptor Information
>8k82 Chain CN (length=112) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQRKLQQDIDKLLKKVKEGIEDFDDIYEKFQSTDPSNSSHREKLESDLKR
EIKKLQKHRDQIKTWLSKEDVKDKQSVLMTNRRLIENGMERFKSVEKLMK
TKQFSKEALTNP
Ligand information
>8k82 Chain C5 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcgccguggcgcaguggaagcgcgcagggcucauaacccugauguccuc
ggaucgaaaccgagcggcgcuacca
<<<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Q57 R60 K69 E87 M90 E91 E97 K101 K103 Q104 F105 S106 K107
Binding residue
(residue number reindexed from 1)		Q56 R59 K68 E86 M89 E90 E96 K100 K102 Q103 F104 S105 K106
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0006368 transcription elongation by RNA polymerase II
GO:0016567 protein ubiquitination
GO:0031087 deadenylation-independent decapping of nuclear-transcribed mRNA
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0030015 CCR4-NOT core complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k82, PDBe:8k82, PDBj:8k82
PDBsum8k82
PubMed38942792
UniProtQ12514|NOT5_YEAST General negative regulator of transcription subunit 5 (Gene Name=NOT5)

[Back to BioLiP]