Structure of PDB 8jiv Chain CN Binding Site BS02

Receptor Information

>8jiv Chain CN (length=203) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRL
GFKAKQGYVVYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSV
AEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILVDVAHSAVRNDPRINWL
CKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATWKRNQTVSLR
RYR

Ligand information

>8jiv Chain Ac (length=152) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgacucucggcaacggauaucucggcucucgcaucgaugaagaacguagc
gaaaugcgauaccuggugugaauugcagaauccgugaaccaucgagucuu
ugaacgcaaguugcgcccgaggggccgagggcacgccugccugggcguca
cg

.........................................<<<<<<.((
.....>>>....<<<<<<......)).............>>>>.>>..>>
>....<<.....>><<<<..<<..>>..>>>>..................
..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
Resolution	2.84 Å
Binding residue (original residue number in PDB)	R38 Q57 Y62 R109 L110 D136 H139
Binding residue (residue number reindexed from 1)	R37 Q56 Y61 R108 L109 D135 H138

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum	8jiv
PubMed	38458197
UniProt	W5FEX7

[Back to BioLiP]