Structure of PDB 4v9k Chain CM Binding Site BS02

Receptor Information
>4v9k Chain CM (length=125) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVAGKKKAPRK
Ligand information
>4v9k Chain CW (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcuacguagcucaguugguuagagcacaucacucauaaugaugggguca
cagguucgaaucccgucguagccacca
<<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<.<<.......>>.>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v9k Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		T116 A118 K126
Binding residue
(residue number reindexed from 1)		T115 A117 K125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9k, PDBe:4v9k, PDBj:4v9k
PDBsum4v9k
PubMed23812722
UniProtP62655|RS13_THET2 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]