Structure of PDB 4v5k Chain CL Binding Site BS02

Receptor Information
>4v5k Chain CL (length=124) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEA
Ligand information
>4v5k Chain CY (length=15) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGFKDYGHDYHPAPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v5k Structural Basis for 16S Ribosomal RNA Cleavage by the Cytotoxic Domain of Colicin E3.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R38 T39 V40 T41
Binding residue
(residue number reindexed from 1)		R37 T38 V39 T40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5k, PDBe:4v5k, PDBj:4v5k
PDBsum4v5k
PubMed20852642
UniProtQ5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]