Structure of PDB 4v7e Chain CJ Binding Site BS02

Receptor Information

>4v7e Chain CJ (length=170) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSTEKKQLNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFS
KARYTVRSFGIRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSD
TGCFGFGIQEHIDLGMKYDPSTGIYGMDFFVVLERAGYRVSRRRRCKARV
GIHQRVTKEDAMKWFQVKYE

Ligand information

>4v7e Chain Ab (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggaugcgaucauaccagcacuaaggcaucggaucccgucagaacuccgaa
guuaagcgugcuugggcgagaguaguacaaggaugggugaccucuuggga
aguccucguguugcauuccc

<<<<<<<<<....<<<<<<<......<<<<<<............>>>>..
>>.....>>>>>.>><<<<<.......<.<<<<.<<....>>>>>>.>..
....>>>>>>>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
Resolution	5.5 Å
Binding residue (original residue number in PDB)	M1 T3 K6 M11 R12 Q17 Q45 V48 Y70 T72 R74 A136 R139 V140 R142 R143 R144 A148 I152 H153 Q154
Binding residue (residue number reindexed from 1)	M1 T3 K6 M11 R12 Q17 Q45 V48 Y70 T72 R74 A136 R139 V140 R142 R143 R144 A148 I152 H153 Q154

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v7e, PDBe:4v7e, PDBj:4v7e
PDBsum	4v7e
PubMed	24499919
UniProt	Q5I7L2

[Back to BioLiP]